PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18649A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 528aa    MW: 57281.6 Da    PI: 4.8948
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18649AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-163784148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT  Ed  lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  Oropetium_20150105_18649A 37 KGPWTSAEDAVLVDYVKKHGEGNWNAVQKNTGLSRCGKSCRLRWANHL 84
                               79******************************************9986 PP

2Myb_DNA-binding52.89.3e-1790133146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +g++T+eE+ l++++++++G++ W++ a++++ gRt++++k++w++
  Oropetium_20150105_18649A  90 KGAFTPEEERLIIQLHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 133
                                799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2893284IPR017930Myb domain
SuperFamilySSF466891.42E-3134131IPR009057Homeodomain-like
SMARTSM007174.6E-143686IPR001005SANT/Myb domain
PfamPF002491.6E-143784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-243891IPR009057Homeodomain-like
CDDcd001679.87E-113984No hitNo description
PROSITE profilePS5129425.65685139IPR017930Myb domain
SMARTSM007172.1E-1789137IPR001005SANT/Myb domain
PfamPF002496.5E-1690133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2692137IPR009057Homeodomain-like
CDDcd001676.43E-1392133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MYRLKSEDDC EMVLQDQMDS PVADDGGSPH KGPPLKKGPW TSAEDAVLVD YVKKHGEGNW  60
NAVQKNTGLS RCGKSCRLRW ANHLRPNLKK GAFTPEEERL IIQLHAKMGN KWARMAAHLP  120
GRTDNEIKNY WNTRIKRCQR AGLPVYPASV CHQSPNEDEQ VSDDFNCSEN RASDFMNGDG  180
LLLPDFTSDN VIPDALSYAP QLSAASISNL LGHSFASRSC SFMDQVDQAG ILKQSGSVLP  240
ALSDTVDGVL SSVDHFSNDS EMLKQALGFD YLNEANACSK TAAPFGVALS GSHAFLNGTF  300
SASRPINGPL KMELPSLQDT ESDPNSWLKY AVVPAMQPTE LVDPYLQSAA VTQSVKSECA  360
SPRNSGLLEE LLHEAQVLRS GNNQQLSVRS SSSSAGTPGE TTTAVSPEFD MGQEYWEEHR  420
GSFLNEYTPF SGYSFTESTA PVSAASLQLS KVSPVQSPSM GSGDQVTEHK YKPGGSPHPE  480
NIRPDAFFSG NTADVSIFND AIAMLLGNDI SSTWSNMPHA CEMSEFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-33331373106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456516.10.0hypothetical protein SORBIDRAFT_03g037680
SwissprotA2WW870.0GAM1_ORYSI; Transcription factor GAMYB
TrEMBLC5XN470.0C5XN47_SORBI; Putative uncharacterized protein Sb03g037680
STRINGSb03g037680.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-89myb domain protein 33